125903-FITC
DMAP1 (DNA Methyltransferase 1-Associated Protein 1, DNMAP1, DNMTAP1, DNMT1-Associated Protein 1, KIAA1425, DKFZp686L09142, EAF2, FLJ11543, SWC4) (FITC)
Size
£914.00
- SKU:
- 125903-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-101 from human DMAP1 (NP_061973) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- DNA methyltransferase 1-associated protein (DMAP1) is found in a wide variety of living organisms from yeasts to humans. MMTR is a part of the basic cellular machinery for a wide range of transcriptional regulation via interaction with TFIIH and HDAC. DMAP1 is incorporated by Bmi1 in polycomb gene silencing. The DMAP1 gene works as a mutagen for tumor suppressor genes by causing hypermethylation and subsequent TA mutations of CpG islands. The direct role of Dnmt1 is restoration of epigenetic information during DNA repair. In eukaryotes the NuA4 histone acetyltransferase (HAT) complex is highly conserved and plays primary role in transcription, cellular response to DNA damage and cell cycle control. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice