125886-PE

DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172) (PE)

Size

£914.00

SKU:: 125886-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa18-110 from human DLL1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The Notch ligand delta-like protein 1 (DLL1) is essential for postnatal arteriogenesis and contributes to tumor progression. DLL1 is involved in differentiation and self-renewal of adipocyte stem cells. Blocks the differentiation of progenitor cells into the B cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor. Applications: Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice