IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231)

Size

£685.00

SKU:: 125863
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa720-819 from human DKFZp434B1231 (NP_840059) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Interacts with FLNC. Interacts with KY. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.