DIP2A (Disco-interacting Protein 2 Homolog A, DIP2 Homolog A, C21orf106, DIP2, KIAA0184)

Size

£685.00

SKU:: 125854
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa107-301 from DIP2A (NP_055966) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DIP2A may provide positional cues for axon pathfinding and patterning in the central nervous system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.