125849-APC

DIO-1 (Death-inducer Obliterator 1, hDido1, Death-associated Transcription Factor 1, DATF-1, DIDO1, C20orf158, DATF1, KIAA0333) (APC)

Size

£927.00

SKU:: 125849-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa321-420 from human DIDO1 (AAH14489) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B1
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Apoptosis plays an important role in many cellular processes. Dio-1 (Death Inducer-O bliterator-1), a putative transcription factor, has been indicated to function in the onset of apoptosis. Dio-1 expression is upregulated when an apoptosis is detected. It translocates to the nucleus, and activates apoptosis during limb development. Dio-1 expression can be suppressed by caspase inhibitors and Bcl-2 expression. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice