125839-BIOTIN
DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (Biotin)
Size
£914.00
- SKU:
- 125839-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3G7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- DHX9, otherwise known as ATP-dependent RNA helicase A, is a transcriptional activator and member of the DEAD box helicase family. DHX9 is a component of the coding region determinant (CRD)-mediated complex and exhibits RNA helicase activity, unwinding double-stranded DNA and RNA in a 3' to 5' direction. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml ELISA: The detection limit is ~3ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DHX9 on human testis Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice