DHRS2 (Dehydrogenase/Reductase SDR Family Member 2, Dicarbonyl Reductase HEP27, Protein D)

Size

£685.00

SKU:: 125822
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa229-300 from DHRS2 (NP_878912) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DHRS2 displays NADPH-dependent dicarbonyl reductase activity in vitro with 3,4-Hexanedione, 2,3-Heptanedione and 1-Phenyl-1,2-propanedione as substrates. DHRS2 do not reductase activity is displayed in vitro with steroids, retinoids and sugars as substrates. This protein may inhibit cell replication. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.