DDX54 (ATP-dependent RNA Helicase DDX54, ATP-dependent RNA Helicase DP97, DEAD Box RNA Helicase 97kD, DEAD Box Protein 54, MGC2835)

Size

£685.00

SKU:: 125742
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa778-881 from human DDX54 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.