DDX43 (Probable ATP-dependent RNA Helicase DDX43, Cancer/Testis Antigen 13, CT13, DEAD Box Protein 43, DEAD Box Protein HAGE, Helical Antigen, HAGE)

Size

£685.00

SKU:: 125736
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-91 from human DDX43 (NP_061135) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Expressed in testis. Expressed in many tumors of various histological types at a level that is 100-fold higher than the level observed in normal tissues except testis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.