125730-PE

DDX3Y (DBY, ATP-dependent RNA Helicase DDX3Y, DEAD Box Protein 3, Y-chromosomal) (PE)

Size

£914.00

SKU:: 125730-PE
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-80 from DDX3Y with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Probable ATP-dependent RNA helicase. May play a role in spermatogenesis. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed and paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.