DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II)

Size

£685.00

SKU:: 125720
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-118 from human DDT (AAH05971) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.