DDAH2 (Dimethylarginine Dimethylaminohydrolase II, NG30, G6a, OTTHUMP00000174406, OTTHUMP00000029307, DADB-110M10.5, OTTHUMP00000062666, NG-dimethylarginine Dimethylamino Hydrolase Homolog, Dimethylarginine Dimethylaminohydrolase II, DDAHII, NG30, G6a, DDAH, Dimethylarginine Dimethylaminohydrolase 2)

Size

£685.00

SKU:: 125699
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-286 from DDAH2 (AAH01435) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DDAH2 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Overexpression of DDAH2 has also been linked to increased VEGF mRNA expression and enhanced tube formation by cells grown in a 3-dimensional medium. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLRLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.