DCTD (Deoxycytidylate Deaminase, dCMP Deaminase)

Size

£685.00

SKU:: 125679
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa69-178 from human DCTD (NM_001921.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Deoxycytidylate deaminase (DCTD; EC 3.5.4.12) catalyzes the deamination of dCMP to dUMP, thus providing the nucleotide substrate for thymidylate synthase (MIM 188350). DCTD is allosterically activated by dCTP and inhibited by dTTP [supplied by OMIM]. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Sequence: RTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.