125679-APC

DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (APC)

Size

£927.00

SKU:: 125679-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa69-178 from human DCTD (NM_001921.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B9
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Deoxycytidylate deaminase (DCTD; EC 3.5.4.12) catalyzes the deamination of dCMP to dUMP, thus providing the nucleotide substrate for thymidylate synthase (MIM 188350). DCTD is allosterically activated by dCTP and inhibited by dTTP [supplied by OMIM]. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Sequence: RTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.