DCLK2 (Serine/Threonine-protein Kinase DCLK2, Doublecortin-like And CAM Kinase-like 2, Doublecortin-like Kinase 2, Doublecortin Domain-containing Protein 3B, CaMK-like CREB Regulatory Kinase 2, CLICK-II, CL2, DCAMKL2, DCDC3B, DCK2)

Size

£685.00

SKU:: 125668
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa348-438 from human DCAMKL2 (AAH32726) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DCAMKL2 is a protein kinase containing an N-terminal doublecortin domain highly homologous to DCX, a microtubule-associated protein with essential participation in the development of the mammalian cerebral cortex. As with other DCAMKL family members, DCAMKL2 possesses microtubule binding activity and, together with DCX, is thought to form a signaling pathway that regulates microtubules in migrating neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.