125668-ML550
DCLK2 (Serine/Threonine-protein Kinase DCLK2, Doublecortin-like And CAM Kinase-like 2, Doublecortin-like Kinase 2, Doublecortin Domain-containing Protein 3B, CaMK-like CREB Regulatory Kinase 2, CLICK-II, CL2, DCAMKL2, DCDC3B, DCK2) (MaxLight 550)
Size
£914.00
- SKU:
- 125668-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa348-438 from human DCAMKL2 (AAH32726) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. DCAMKL2 is a protein kinase containing an N-terminal doublecortin domain highly homologous to DCX, a microtubule-associated protein with essential participation in the development of the mammalian cerebral cortex. As with other DCAMKL family members, DCAMKL2 possesses microtubule binding activity and, together with DCX, is thought to form a signaling pathway that regulates microtubules in migrating neurons. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice