DCBLD2 (CLCP1, ESDN, Discoidin, CUB and LCCL Domain-containing Protein 2, CUB, LCCL and Coagulation Factor V/VIII-homology Domains Protein 1, Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein)

Size

£685.00

SKU:: 125660
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa80-165 from human DCBLD2 (NP_563615) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.