125660-ML650
DCBLD2 (CLCP1, ESDN, Discoidin, CUB and LCCL Domain-containing Protein 2, CUB, LCCL and Coagulation Factor V/VIII-homology Domains Protein 1, Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein) (MaxLight 650)
Size
£914.00
- SKU:
- 125660-ML650
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa80-165 from human DCBLD2 (NP_563615) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice