DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK)

Size

£685.00

SKU:: 125629
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1211-1310 from human DAPK1 (NP_004929) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DAPK1, a DAPK type protein kinase, is a positive mediator of gamma-interferon induced programmed cell death. It is believed to function in an early apoptotic checkpoint designed to eliminate premalignant cells from cancer development. The DAPK1 protein contains eight ankyrin repeats and two putative P-loop consensus sites. Loss of DAPK1 expression has been associated with invasive tumors. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.