125629-BIOTIN
DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (Biotin)
Size
£927.00
- SKU:
- 125629-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1211-1310 from human DAPK1 (NP_004929) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- DAPK1, a DAPK type protein kinase, is a positive mediator of gamma-interferon induced programmed cell death. It is believed to function in an early apoptotic checkpoint designed to eliminate premalignant cells from cancer development. The DAPK1 protein contains eight ankyrin repeats and two putative P-loop consensus sites. Loss of DAPK1 expression has been associated with invasive tumors. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice