DAAM2 (Disheveled-associated Activator Of Morphogenesis 2, KIAA0381)

Size

£760.00

SKU:: 125617
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human DAAM2, aa1-132 (AAH47575.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DAAM2 is a 1068aa protein belonging to the formin homology family. It contains one of each DAD (diaphanous autoregulatory), FH1 (formin homology 1), FH2 (formin homology 2) and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. Its main function is actin cytoskeleton organization, thus leading to cell organization and biogenesis. It plays a role in Rho GTPase binding and is expressed mostly in spinal cord and nerve tissues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.