Cystatin A (Stefin A, Cystatin-A, Cystatin-AS, Stefin-A, CSTA, STF1, STFA)

Size

£685.00

SKU:: 125607
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-98 from human Cystatin A with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Cystatin A (acid cysteine proteinase inhibitor, ACPI) is a natural inhibitor of cysteine proteinases and is located mainly in the keratohyaline granules of the stratum granulosum and the cornified envelope of the stratum corneum in the epidermis. Human cystatin A consists of 98aa residues and belongs to cystatin subfamily I (stefins). Among the target enzymes inhibited by cystatin A are cathepsins B, C, H, L, and S, papain and actinidin. Cystatin A has also been detected in infiltrative breast carcinoma. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.