CYLN2 (CAP-Gly Domain-containing Linker Protein 2, Cytoplasmic Linker Protein 115, CLIP-115, Cytoplasmic Linker Protein 2, Williams-Beuren Syndrome Chromosomal Region 3 Protein, Williams-Beuren Syndrome Chromosomal Region 4 Protein, CLIP2, KIAA0291, WBSCR3, WBSCR4, WSCR4)

Size

£685.00

SKU:: 125553
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa946-1046 from human CYLN2 (NP_003379) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.