125533-PE

Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (PE)

Size

£914.00

SKU:: 125533-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-90 from human CCNB1 (NP_114172) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Cyclins were originally discovered as proteins whose accumulation during the interphase and destruction at mitosis played a critical role in the progression through the eukaryotic cell cycle. It was subsequently found that cyclins control the cell cycle by binding to Ser/Thr cyclin-dependent kinases (CDKs) and regulating their activities. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. Cyclin B is essential for the control of the cell cycle at the G2/M (mitosis) transition. The expression of cyclin B1 is cell-cycle regulated, peaking at the G2/M transition. It interacts with the CDC2 protein kinase to form a serine/threonine kinase holoenzyme complex also known as maturation promoting factor (MPF), and thus the complex regulates the progression of cells through G2 into M phase. It maps to 5q12 region of human chromosome. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice