CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6)

Size

£685.00

SKU:: 125509
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-115 from human CXCL6 (AAH13744) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Chemotactic for neutrophil granulocytes. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.