125508
CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6)
Size
£760.00
- SKU:
- 125508
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CXCL6, aa1-114 (NP_002984.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Chemotactic for neutrophil granulocytes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice