CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A)

Size

£685.00

SKU:: 125501
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-89 from human CXCL12 (AAH39893) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CXCL12, also known as pre-B-cell growth-stimulating factor (PBSF) or stromal cell-derived factor-a (SDF-1a), is a 70aa CXC chemokine originally cloned from a bone marrow stromal cell line. Targeted deletion of CXCL12 gene resulted in defects of B-cell lymphopoiesis and bone marrow myelopoiesis. CXCL12 has been shown to be chemotactic for lymphocytes. In addition, CXCL12 was recently reported to be a ligand for CXCR4 (LESTR/fusin), a co-receptor for HIV-1 entry into T cells. CXCL12 binding to CXCR4 inhibits HIV-1 entry. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.