CXCL10 (IP-10, C-X-C Motif Chemokine 10, 10kD Interferon gamma-induced Protein, Gamma-IP10, Small-inducible Cytokine B10, INP10, SCYB10)

Size

£760.00

SKU:: 125497
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CXCL10, aa1-98 (NP_001556.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.