125496-HRP

CXCL1 (Growth-regulated alpha Protein, C-X-C Motif Chemokine 1, GRO-alpha(1-73), Melanoma Growth Stimulatory Activity, MGSA, Neutrophil-activating Protein 3, NAP-3, GRO, GRO1, GROA, SCYB1) (HRP)

Size

£914.00

SKU:: 125496-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa36-107 from human CXCL1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).
Extra Details:: GRO Alpha (CXCL1), a small cytokine belonging to the CXC chemokine family, secreted by human melanoma cells, has mitogenic properties and is implicated in melanoma pathogenesis. GRO alpha is expressed by macrophages, neutrophils and epithelial cells, and has neutrophil chemoattractant activity. GRO Alpha plays a role in spinal cord development by inhibiting the migration of oligodendrocyte precursors and is involved in the processes of angiogenesis, inflammation, wound healing, and tumorigenesis. This chemokine elicits its effects by signaling through the chemokine receptor CXCR2. An initial study in mice showed evidence that GRO alpha decreased the severity of multiple sclerosis and may offer a neuro-protective function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice