Cullin 7 (CUL7, Cullin-7, CUL-7, KIAA0076)

Size

£685.00

SKU:: 125486
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-100 from human Cullin 7 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Cullins (1, 2, 3, 4a, 5 and 7) are a family of proteins that assemble a large number of ubiquitin ligases to catalyse polyubiquitiation, as well as binding to various specific factors to recruit substrates. Cullin 7 (CUL 7) is a component of SCF-like E3 ubiquitin ligase complex and may play a role in the degradation of proteins involved in endothelial proliferation and/or differentiation. Cullin 7 is a new oncogene that cooperates with Myc in transformation by blocking Myc-induced apoptosis in a p53-dependent manner. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.