125486-APC
Cullin 7 (CUL7, Cullin-7, CUL-7, KIAA0076) (APC)
Size
£927.00
- SKU:
- 125486-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-100 from human Cullin 7 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G11
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Cullins (1, 2, 3, 4a, 5 and 7) are a family of proteins that assemble a large number of ubiquitin ligases to catalyse polyubiquitiation, as well as binding to various specific factors to recruit substrates. Cullin 7 (CUL 7) is a component of SCF-like E3 ubiquitin ligase complex and may play a role in the degradation of proteins involved in endothelial proliferation and/or differentiation. Cullin 7 is a new oncogene that cooperates with Myc in transformation by blocking Myc-induced apoptosis in a p53-dependent manner. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice