125482-HRP

Cullin 3 (Cullin-3, CUL3, CUL-3, KIAA0617) (HRP)

Size

£914.00

SKU:: 125482-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa301-400 from CUL3 (AAH39598) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Cullins are scaffold proteins in the E3 ligase complex and forms a catalytic core complex with Roc1/Rbx1/Hrt1, with Roc1 recruiting a cognate E2 enzyme. They are major components of SCF complexes, and have been implicated in degradation of key regulatory molecules including Cyclin E, beta-catenin and Cubitus interruptus. Six Cul protein members have been identified in mammals: Cul1, Cul2, Cul3, Cul4A, Cul4B, and Cul5. Cullin 3 forms a tight complex with cyclin E and is involved in its ubiquitination, thus regulates G1/S transition. It is also involved in ubiquitination of both BMI1/PCGF4 and H2AFY, in complex with SPOP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice