125475
CTSS (Cathepsin S, MGC3886)
Size
£760.00
- SKU:
- 125475
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CTSS, aa1-331 (NP_004070.3).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Cathepsin family of proteases contains several diverse classes of enzymes. The cysteine protease class comprises cathepsin B, H, K, L, O, and S. The aspartyl protease class contains cathepsin D and E. Cathepsin G belongs to the serine protease class. Cathepsins are involved in various cellular events such as peptide biosynthesis, protein degradation, and apoptosis. Cathepsin S has been shown to be present in aveloar macrophages. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice