CTNA1 (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1)

Size

£685.00

SKU:: 125446
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa152-250 from human CTNNA1 (NP_001894) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CTNA1 associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. The protein may play a crucial role in cell differentiation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.