CST6 (Cystatin-M, Cystatin-6, Cystatin-E)

Size

£685.00

SKU:: 125419
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa29-149 from human CST6 (AAH31334) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CST6 is a member of the type 2 cystatin family. Some of the members are active cysteine protease inhibitors, while cystatin E/M moderate the inhibition of cathepsin B but is not active against cathepsin C. CST6 is secretable proteins that influence osteogenesis and bone resorption, regulation of the insulin and hepatocyte growth factor receptors, and the response to systemic inflammation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.