CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034)

Size

£685.00

SKU:: 125415
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa445-539 from human CSPG5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C11
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: CSPG5 may function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.