CSE1L (Chromosome Segregation 1-like Protein, Cellular Apoptosis Susceptibility Protein, CAS, CSE1, Exportin-2, Exp2, Importin-alpha Re-exporter, XPO2)

Size

£685.00

SKU:: 125388
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa872-971 from human CSE1L (NP_001307) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Cellular Apoptosis Susceptibility (CAS) protein is asso- ciated with microtubules and the mitotic spindle. The correlation with cell proliferation and apoptosis are yet to be fully determined but the protein may be involved with development of certain leukemias and lymphomas. High expression has been reported to correspond with proliferation of normal and malignant lymphoid cells. This antibody with help detect CAS protein and further elucidate its role in cellular apoptosis. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice