125388-ML490
CSE1L (Chromosome Segregation 1-like Protein, Cellular Apoptosis Susceptibility Protein, CAS, CSE1, Exportin-2, Exp2, Importin-alpha Re-exporter, XPO2) (MaxLight 490)
Size
£914.00
- SKU:
- 125388-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa872-971 from human CSE1L (NP_001307) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Cellular Apoptosis Susceptibility (CAS) protein is asso- ciated with microtubules and the mitotic spindle. The correlation with cell proliferation and apoptosis are yet to be fully determined but the protein may be involved with development of certain leukemias and lymphomas. High expression has been reported to correspond with proliferation of normal and malignant lymphoid cells. This antibody with help detect CAS protein and further elucidate its role in cellular apoptosis. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice