CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog, hSur-2, Transcriptional Coactivator CRSP130, Vitamin D3 Receptor-interacting Protein Complex 130kD Component, DRIP130, ARC130, MED23, DRIP130, KIAA1216, SUR2)

Size

£685.00

SKU:: 125351
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa531-630 from CRSP3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Required for transcriptional activation subsequent to the assembly of the preinitiation complex By similarity. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice