125351-PE
CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog, hSur-2, Transcriptional Coactivator CRSP130, Vitamin D3 Receptor-interacting Protein Complex 130kD Component, DRIP130, ARC130, MED23, DRIP130, KIAA1216, SUR2) (PE)
Size
£914.00
- SKU:
- 125351-PE
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa531-630 from CRSP3 (NP_004821) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4H6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Required for transcriptional activation subsequent to the assembly of the preinitiation complex By similarity. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice