125348-BIOTIN

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (Biotin)

Size

£927.00

SKU:: 125348-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa221-310 from human CRMP1 (NP_001014809.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Collapsin-response mediator proteins (CRMPs) are highly expressed in the developing brain where they play major roles in axonal outgrowth, neurite differentiation, and apoptosis. Their continued expression in areas of high synaptic remodeling such as the cerebellum, hippocampus, and the olfactory system suggests that these proteins may also be involved in adult brain plasticity. CRMP-1 was initially identified as a dihydro- pyrimidinase expressed exclusively in brain; later studies have shown that it is involved with neurotrophin (NT) 3-induced neurite formation and outgrowth. CRMP-1 localization switches from axonal to somatodendritic when neurons reach functional maturity, suggesting that it is involved in early neuronal differentiation as well as in later processes related to the survival or death of the newly generated neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice