125344-PE
CRLF2 (Cytokine Receptor-like Factor 2, Cytokine Receptor-like 2, IL-XR, Thymic Stromal Lymphopoietin Protein Receptor, TSLP Receptor, CRL2, ILXR, TSLPR) (PE)
Size
£914.00
- SKU:
- 125344-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa23-133 from human CRLF2 (NP_071431) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4A11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- TSLP receptor is a member of the hematopoietin receptor family which acts as a receptor for the cytokine thymic stromal lymphopoietin (TSLP) that promotes CD4(+) T cell homeostasis and contributes to allergic and inflammatory responses. TSLP receptor is a heterodimeric complex, consisting of the IL-7R-alpha chain and a common gamma-like receptor chain. The protein contains two fibronectin type III-like domains, four conserved cysteine residues, and a WSXWS box-like motif at it's N-terminal, while the C-terminal intracellular region contains box 1 and box 2-like motifs. The protein is usually expressed in liver, kidney, heart, and skeletal muscle. The gene for human TSLP receptor is localized to the pseudoautosomal region, Xp22.3 and Yp11.3. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice