125344-BIOTIN
CRLF2 (Cytokine Receptor-like Factor 2, Cytokine Receptor-like 2, IL-XR, Thymic Stromal Lymphopoietin Protein Receptor, TSLP Receptor, CRL2, ILXR, TSLPR) (Biotin)
Size
£927.00
- SKU:
- 125344-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa23-133 from human CRLF2 (NP_071431) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4A11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- TSLP receptor is a member of the hematopoietin receptor family which acts as a receptor for the cytokine thymic stromal lymphopoietin (TSLP) that promotes CD4(+) T cell homeostasis and contributes to allergic and inflammatory responses. TSLP receptor is a heterodimeric complex, consisting of the IL-7R-alpha chain and a common gamma-like receptor chain. The protein contains two fibronectin type III-like domains, four conserved cysteine residues, and a WSXWS box-like motif at it's N-terminal, while the C-terminal intracellular region contains box 1 and box 2-like motifs. The protein is usually expressed in liver, kidney, heart, and skeletal muscle. The gene for human TSLP receptor is localized to the pseudoautosomal region, Xp22.3 and Yp11.3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice