CORO1C (Coronin 3, Coronin-1C, Coronin-3, hCRNN4, CRNN4)

Size

£685.00

SKU:: 125239
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa375-474 from CORO1C (NP_055140) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Coronin 3 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40aa typically bracketed by gly-his and trp-asp (GH-WD). These may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. By similarity, Coronin 3 may be involved in cytokinesis, motility, and signal transduction. Coronin 3 is ubiquitously expressed in all human tissues, in contrast to other known coronin-like molecules, each of which is expressed in a tissue-specific manner. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice