Corneodesmosin (CDSN, S Protein)

Size

£685.00

SKU:: 125236
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa306-355 from human CDSN (NM_001264, NP_001255) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CDSN (Corneodesmosin; also S protein) is a 52-56kD, secreted glycoprotein that has an unusually high content of Gly, Pro and Ser. It is found in the desmosomes of spinous layer keratinocytes, and presumably uses its high Gly content to generate homophilic noncovalent intercellular bridges. Mature human CDSN is 497aa in length. It contains a Ser-rich region (aa62-464) and one Gly-rich domain (aa60-17.1). CDSN undergoes sequential proteolytic processing to generate multiple fragments that vary in size from 46-43kD, to 35-30kD, to 15kD. This sequential extracellular processing allows initially for CDSN incorporation into a functional adhesional junction, and later for the removal of adhesional glycine loops with a subsequent dissociation (desquamation) of cells. There is one potential isoform termed the S protein that shows a two aa substitution for the C-terminal 29aa. Over aa33-529, human CDSN shares 68% aa identity with mouse CDSN. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice