CORIN (Atrial Natriuretic Peptide-converting Enzyme, Pro-ANP-converting Enzyme, Corin, Heart-specific Serine Proteinase ATC2, Transmembrane Protease, Serine 10, Atrial Natriuretic Peptide-converting Enzyme, N-terminal Propeptide, Atrial Natriuretic Peptide-converting Enzyme, N-terminal Propeptide, TMPRSS10, CRN)

Size

£685.00

SKU:: 125235
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa616-715 from human CORIN with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. This protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.