125221-BIOTIN

COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (Biotin)

Size

£927.00

SKU:: 125221-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa854-953 from human COPB (NP_057535) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The Golgi complex is a key organelle where processing and sorting of newly synthesized proteins occurs. Membrane traffic from the endoplasmic reticulum (ER) to the Golgi complex and from the Golgi complex to the different final cellular destinations is believed to be mediated by carrier vesicles. Two populations of coated vesicles mediate biosynthetic membrane traffic between the different membrane-bound compartments. Clathrin-coated vesicles carry proteins to endocytic organelles and secretory granules, whilst non-clathrin-coated vesicles are involved in intra-Golgi transport and transport from the ER to the Golgi complex. Beta COP is a member of a set of protein which are believed to associate with the non-clathrin coated vesicles. Golgi-derived non-clathrin-coated vesicles are believed to act as bulk carriers, whereas clathrin-coated vesicles carry a selective cargo of membrane proteins. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice