125215
Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4)
Size
£685.00
- SKU:
- 125215
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human GJB4, aa1-266 (NP_694944.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Gap junctions permit direct cell-to-cell passage of small cytoplasmic molecules, including ions, metabolic intermediates, and second messengers, and thereby mediate intercellular communication. Gap junction channels consist of connexin protein subunits encoded by a multigene family. Erythrokeratodermia variabilis (EKV) is an autosomal dominant disorder of keratinization characterized by migratory erythematous lesions and fixed keratotic plaques. Mutations in the GJB3 gene have been reported in some but not all families, although it has been postulated that the absence of connexin 30.3 can be compensated by other connexins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice