125209-BIOTIN

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (Biotin)

Size

£927.00

SKU:: 125209-BIOTIN
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa19-118 from human Complement Factor I with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Complement Factor I is a member of the peptidase S1 family present in the blood plasma. Factor I is an 88kD protein consisting of one polypeptide chain of 35.4kD and one of 27.6kD. Factor I is a serine protease which inactivates complement components C3b and C4b. C3b cleavage requires the presence of cofactors complement component (3b/4b) receptor 1 (CR1), membrane cofactor protein or factor H, while C4b cleavage requires complement component 4 binding protein or CR1. Factor I has no natural inhibitors. Dysfunctional factor I can lead to uncontrolled activation of the alternative complement pathway causing systemic depletion of C3 and lowering levels of factors B and H, resulting in recurrent pyogenic infections. Defects in CFI are also associated with haemolytic uraemic syndrome. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice