125209-APC

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (APC)

Size

£927.00

SKU:: 125209-APC
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa19-118 from human Complement Factor I with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B3
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Complement Factor I is a member of the peptidase S1 family present in the blood plasma. Factor I is an 88kD protein consisting of one polypeptide chain of 35.4kD and one of 27.6kD. Factor I is a serine protease which inactivates complement components C3b and C4b. C3b cleavage requires the presence of cofactors complement component (3b/4b) receptor 1 (CR1), membrane cofactor protein or factor H, while C4b cleavage requires complement component 4 binding protein or CR1. Factor I has no natural inhibitors. Dysfunctional factor I can lead to uncontrolled activation of the alternative complement pathway causing systemic depletion of C3 and lowering levels of factors B and H, resulting in recurrent pyogenic infections. Defects in CFI are also associated with haemolytic uraemic syndrome. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice